PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015712
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 319aa    MW: 36131.4 Da    PI: 8.5376
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015712genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eEd++l+  v+++G g+W+t + + g+ R++k+c++rw +yl
      Lus10015712  9 RGPWSSEEDQKLLSFVQLHGHGSWRTLPPKAGLQRCGKSCRLRWINYL 56
                     89********************************************97 PP

2Myb_DNA-binding54.23.4e-1762107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++  E++ +++++++lG++ W++Ia++++ +Rt++++k++w+++l
      Lus10015712  62 RGKFSLHEEQTIIQLHALLGNR-WSAIAAHLP-RRTDNEIKNHWNTHL 107
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.589456IPR017930Myb domain
SuperFamilySSF466892.4E-296103IPR009057Homeodomain-like
SMARTSM007171.8E-11858IPR001005SANT/Myb domain
PfamPF002497.7E-15956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-211063IPR009057Homeodomain-like
CDDcd001674.92E-91156No hitNo description
PROSITE profilePS5129425.58357111IPR017930Myb domain
SMARTSM007172.3E-1661109IPR001005SANT/Myb domain
PfamPF002491.1E-1562107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2664111IPR009057Homeodomain-like
CDDcd001673.91E-1164107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDISVGLRRG PWSSEEDQKL LSFVQLHGHG SWRTLPPKAG LQRCGKSCRL RWINYLRPGI  60
KRGKFSLHEE QTIIQLHALL GNRWSAIAAH LPRRTDNEIK NHWNTHLKKR LSLMGIDPAT  120
HKSKTATLRR LDGGDPKNAS TLSHMAQWES ARLEAEARLV RESNLLRDHH QQQPNPAMQH  180
HHDQALLNKM ASSSRLAPPR CLDVLRVWQN QHNNFQGHDG HHHDNNIYAW HSSSSPPWPR  240
LMESTLLDGD GTSTTSSGTR GINLVGKSVA QVISNDEEAG DALFVDYWIR DDDGDQLVDL  300
QVDWNSTSWT AMDRTNDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2671115108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438735.14e-97hypothetical protein CICLE_v10033327mg
RefseqXP_006440626.13e-97hypothetical protein CICLE_v10023440mg
TrEMBLA0A067EK162e-97A0A067EK16_CITSI; Uncharacterized protein
STRINGGLYMA20G04240.22e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.18e-89myb domain protein 106